Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRK QEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA QGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
    • Amino acids
      1 to 134
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6Ckine
    • Beta-chemokine exodus-2
    • C C motif chemokine ligand 21
    • C-C motif chemokine 21
    • CCL21
    • CCL21_HUMAN
    • Chemokine (C-C motif) ligand 21
    • Chemokine CC motif ligand 21
    • CKb9
    • ECL
    • Efficient Chemoattractant for Lymphocytes
    • SCYA21
    • Secondary lymphoid-tissue chemokine
    • SLC
    • Small inducible cytokine A21
    • Small inducible cytokine subfamily A (Cys-Cys), member 21
    • Small-inducible cytokine A21
    • TCA4
    • UNQ784/PRO1600
    see all
  • Function
    Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs.
  • Tissue specificity
    Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159489 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up