Recombinant Human CCL4L1 protein (ab107149)

Overview

  • Product name
    Recombinant Human CCL4L1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFV VDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
    • Molecular weight
      11 kDa including tags
    • Amino acids
      24 to 92
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107149 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5

General Info

  • Alternative names
    • AT744.2
    • C-C motif chemokine 4-like
    • CC4L_HUMAN
    • CCL4L
    • CCL4L2
    • LAG 1
    • LAG-1
    • LAG1
    • Lymphocyte activation gene 1 protein
    • Macrophage inflammatory protein 1-beta
    • MIP-1-beta
    • Monocyte adherence-induced protein 5-alpha
    • SCYA4L
    • Small-inducible cytokine A4-like
    see all
  • Function
    Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5.
  • Tissue specificity
    Detected in B-cells.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human CCL4L1 protein images

  • 15% SDS-PAGE showing ab107149 (3µg).
    Note: Molecular weight on SDS-PAGE will appear higher than predicted.

References for Recombinant Human CCL4L1 protein (ab107149)

ab107149 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up