Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEEEGKKGKKPGIVSPFKRVFLKGEKSRDK KAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYL NPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDI ILRVPIHDIAAVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAG SLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQVVYTESTIDFLD RAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGAS PHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGAS IHEFCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGI ITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISS DIEALGCSMDQDSA
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 444
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    Purity is >95%, by SDS-PAGE and silver stain.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Constituent: PBS

  • Reconstitution
    ab113197 is soluble in water and most aqueous buffers and should be reconstituted in water or medium containing at least 0.1% Human or BSA to a concentration not lower than 50 µg/ml.

General Info

  • Alternative names
    • C7orf22
    • Ccm2
    • CCM2 gene
    • CCM2_HUMAN
    • Cerebral cavernous malformation 2
    • Cerebral cavernous malformations 2 protein
    • Chromosome 7 open reading frame 22
    • Malcavernin
    • MGC4067
    • MGC4607
    • MGC74868
    • OSM
    • Osmosensing scaffold for MEKK3
    • OTTHUMP00000159554
    • OTTHUMP00000214270
    • OTTHUMP00000214271
    • OTTHUMP00000214273
    • PP10187
    see all
  • Function
    May function as a scaffold protein for MAP2K3-MAP3K3 signaling. Seems to play a major role in the modulation of MAP3K3-dependent p38 activation induced by hyperosmotic shock.
  • Involvement in disease
    Defects in CCM2 are the cause of cerebral cavernous malformations type 2 (CCM2) [MIM:603284]. Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and are usually present clinically during the 3rd to 5th decades of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters.
  • Sequence similarities
    Contains 1 PID domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE of human recombinant CCM2 (ab113197). The sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with silver stain.

References

ab113197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up