Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFTQRCPPQCPGRCPATPPTCAP GVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGIC TAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPE PNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDS SVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQE PEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCT PHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKT TRGKM
    • Molecular weight
      39 kDa including tags
    • Amino acids
      32 to 357
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Full length mature form. T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_002505.1.

Specifications

Our Abpromise guarantee covers the use of ab182816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • CCN family member 3
    • CCN3
    • IBP-9
    • IGF-binding protein 9
    • IGFBP-9
    • IGFBP9
    • Insulin-like growth factor-binding protein 9
    • Nephroblastoma overexpressed
    • Nephroblastoma overexpressed gene protein homolog
    • Nephroblastoma-overexpressed gene protein homolog
    • NOV
    • NOV_HUMAN
    • NovH
    • Protein NOV homolog
    see all
  • Function
    Immediate-early protein likely to play a role in cell growth regulation.
  • Tissue specificity
    Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type.
  • Sequence similarities
    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab182816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up