Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTI QAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
    • Amino acids
      260 to 357

Specifications

Our Abpromise guarantee covers the use of ab79564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 1X PBS

General Info

  • Alternative names
    • CCN family member 3
    • CCN3
    • IBP-9
    • IGF-binding protein 9
    • IGFBP-9
    • IGFBP9
    • Insulin-like growth factor-binding protein 9
    • Nephroblastoma overexpressed
    • Nephroblastoma overexpressed gene protein homolog
    • Nephroblastoma-overexpressed gene protein homolog
    • NOV
    • NOV_HUMAN
    • NovH
    • Protein NOV homolog
    see all
  • Function
    Immediate-early protein likely to play a role in cell growth regulation.
  • Tissue specificity
    Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type.
  • Sequence similarities
    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human CCN3 protein images

  • ab79564 on 15% SDS PAGE gel, Coomassie blue staining.

References for Recombinant Human CCN3 protein (ab79564)

ab79564 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab79564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up