Recombinant Human CCNB1IP1 protein (ab163657)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPA CNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQV HQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVL EEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMI AQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSN SFFSFVSPSRELEQQQVSSRAFKVKRI
    • Amino acids
      1 to 277
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C14orf18
    • CCNB1IP1
    • Chromosome 14 open reading frame 18
    • CIP1_HUMAN
    • Cyclin B1 interacting protein 1
    • cyclin B1 interacting protein 1, E3 ubiquitin protein ligase
    • Cyclin-B1-interacting protein 1
    • E3 ubiquitin-protein ligase CCNB1IP1
    • Enhancer of invasion 10
    • Gm288
    • HEI10
    • Human enhancer of invasion 10
    • mei4
    see all
  • Function
    E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
  • Tissue specificity
    Highly expressed in heart. Detected at intermediate levels in liver and kidney, and at low levels in placenta, brain and lung.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Ubiquitinated; autoubiquitinated.
    Phosphorylated by CDK1 on serine or threonine residues (in vitro).
  • Cellular localization
    Nucleus. Chromosome. May associate with segregating chromosomes during metaphase and anaphase.
  • Information by UniProt

Images

  • ab163657 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up