Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSL LGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWV FGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMG TTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNF KMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLF WVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSS VDYIL
    • Amino acids
      1 to 355
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C C chemokine receptor type 8
    • C C CKR 8
    • C C motif chemokine receptor 8
    • C-C chemokine receptor type 8
    • C-C CKR-8
    • CC chemokine receptor 8
    • CC chemokine receptor CHEMR1
    • CC chemokine receptor type 8
    • CC CKR 8
    • CC-CKR-8
    • CCR 8
    • CCR-8
    • Ccr8
    • CCR8 protein
    • CCR8-L
    • CCR8_HUMAN
    • CDw198
    • CDw198 antigen
    • Chemokine (C C motif) receptor 8
    • Chemokine (C C) receptor 8
    • Chemokine (C C) receptor like 2
    • Chemokine (CC motif) receptor 8
    • Chemokine (CC) receptor 8
    • Chemokine (CC) receptor like 1
    • Chemokine (CC) receptor like 2
    • Chemokine C C motif receptor 8
    • Chemokine C C receptor 8
    • Chemokine CC motif receptor 8
    • Chemokine CC receptor 8
    • Chemokine receptor 8
    • Chemokine receptor like 1
    • Chemokine receptor-like 1
    • CKR L1
    • CKR-L1
    • CKRL 1
    • CKRL1
    • CMKBR 8
    • CMKBR L2
    • CMKBR8
    • CMKBRL 2
    • CMKBRL2
    • CY 6
    • CY6
    • GPR CY6
    • GPR-CY6
    • GPRCY6
    • MGC123958
    • MGC123959
    • MGC129966
    • MGC129973
    • TER 1
    • TER1
    see all
  • Function
    Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158145 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up