Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEV LPDVSPQALDLLGQFLLYPPHQRIA
    • Amino acids
      183 to 257
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAK kinase p42
    • CAK-kinase p42
    • CCRK
    • CDCH
    • CDK activating kinase p42
    • CDK-activating kinase p42
    • cdk20
    • CDK20_HUMAN
    • Cell cycle related kinase
    • Cell cycle-related kinase
    • Cell division protein kinase 20
    • Cyclin dependent protein kinase H
    • Cyclin kinase activating kinase p42
    • Cyclin-dependent kinase 20
    • Cyclin-dependent protein kinase H
    • Cyclin-kinase-activating kinase p42
    • p42
    • PNQALRE
    see all
  • Function
    Required for high-level Shh responses in the developing neural tube. Together with BROMI, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in response to SHH signaling (By similarity). Involved in cell growth. Activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue 'Thr-160'.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Nucleus. Cytoplasm. Cell projection > cilium.
  • Information by UniProt

Images

  • ab161684 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up