Overview

  • Product name
    Recombinant Human CCRL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FVIGVLDNLLVVLILVKYKGLKRAENIYLLNLAVSNLCFLLTLPFWAHAG GDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCG IITSVLAWVTAILATLPEYVVYKPQMEDQKYKCAFSRTPFLPADETFWKH FLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFL LMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPL LYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
    • Amino acids
      49 to 344
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C-C chemokine receptor-like 2
    • CCRL2
    • CCRL2_HUMAN
    • Chemokine (C-C motif) receptor like 2
    • Chemokine receptor CCR11
    • Chemokine receptor X
    • CKRX
    • CRAM A
    • CRAM B
    • CRAMA
    • CRAMB
    • FLJ55815
    • HCR
    • MGC116710
    • MGC34104
    • Putative MCP 1 chemokine receptor
    • Putative MCP-1 chemokine receptor
    see all
  • Function
    Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses.
  • Tissue specificity
    Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (both CD4+ and CD8+), monocyte-derived iDCs, NK cells, and CD34+ progenitor cells. B cells expressed isoform 1 but not isoform 2. Up-regulated on synovial neutrophils of rheumatoid arthritis patients.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Domain
    Lacks the conserved DRYLAIV motif in the second intracellular loop that is required for signaling of functional chemokine receptors.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab152942 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up