Overview

  • Product name
    Recombinant Human CCT3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLL DPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIIL AGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDM MLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARV EKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGE SQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQ HYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLE IKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNV LLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTL IQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDMKELGIWEPLAV KLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE
    • Molecular weight
      87 kDa including tags
    • Amino acids
      2 to 545

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCT 3
    • CCT gamma
    • CCT-gamma
    • CCT3
    • CCTG
    • Chaperonin containing TCP1 subunit 3
    • Chaperonin containing TCP1 subunit 3 (gamma)
    • hTRiC5
    • PIG48
    • T complex protein 1 gamma subunit
    • T complex protein 1 subunit gamma
    • T-complex protein 1 subunit gamma
    • TCP 1 gamma
    • TCP-1-gamma
    • TCP1 (t complex 1) ring complex polypeptide 5
    • TCPG_HUMAN
    • TRIC5
    see all
  • Function
    Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.
  • Sequence similarities
    Belongs to the TCP-1 chaperonin family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152767 stained with Coomassie Blue.

References

ab152767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up