Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08473
    • SpeciesHuman
    • SequenceNESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSK YGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTA YVDFM
    • Molecular weight37 kDa including tags
    • Amino acids145 to 249

Specifications

Our Abpromise guarantee covers the use of ab114211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Atriopeptidase
    • CALLA
    • CD10
    • CD10 antigen
    • Common acute lymphocytic leukemia antigen
    • DKFZp686O16152
    • EC 3.4.24.11
    • Enkephalinase
    • EPN
    • Membrane metallo endopeptidase
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase)
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10)
    • Membrane metallo endopeptidase variant 1
    • Membrane metallo endopeptidase variant 2
    • Membrane metalloendopeptidase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase CALLA CD10
    • Membrane metalloendopeptidase variant 1
    • Membrane metalloendopeptidase variant 2
    • MGC126681
    • MGC126707
    • MME
    • NEP
    • NEP_HUMAN
    • Neprilysin
    • neprilysin-390
    • neprilysin-411
    • Neutral endopeptidase
    • Neutral endopeptidase 24.11
    • Neutral endopeptidase, membrane-associated
    • SFE
    • Skin fibroblast elastase
    see all
  • FunctionThermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids. Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond. Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9. Involved in the degradation of atrial natriuretic factor (ANF). Displays UV-inducible elastase activity toward skin preelastic and elastic fibers.
  • Sequence similaritiesBelongs to the peptidase M13 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human CD10 protein images

  • 12.5% SDS-PAGE analysis of ab114211 stained with Coomassie Blue.

References for Recombinant Human CD10 protein (ab114211)

ab114211 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"