Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETS SRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDS RGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLI NLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMIS VARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYN KMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEY LTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGT TSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVF IQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELN YKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRN QIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDG DLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIAD NGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPE YAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
    • Molecular weight
      107 kDa
    • Amino acids
      52 to 750

Specifications

Our Abpromise guarantee covers the use of ab155720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    ab155720 migrates at 120-130 kDa in reduced SDS-PAGE due to glycosylation.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

  • Reconstitution
    It is recommended to reconstitute ab155720 in sterile PBS to a final concentration of 100 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Avoid vigorous shaking or vortexing.

General Info

  • Alternative names
    • Atriopeptidase
    • CALLA
    • CD10
    • CD10 antigen
    • Common acute lymphocytic leukemia antigen
    • DKFZp686O16152
    • EC 3.4.24.11
    • Enkephalinase
    • EPN
    • Membrane metallo endopeptidase
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase)
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10)
    • Membrane metallo endopeptidase variant 1
    • Membrane metallo endopeptidase variant 2
    • Membrane metalloendopeptidase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase CALLA CD10
    • Membrane metalloendopeptidase variant 1
    • Membrane metalloendopeptidase variant 2
    • MGC126681
    • MGC126707
    • MME
    • NEP
    • NEP_HUMAN
    • Neprilysin
    • neprilysin-390
    • neprilysin-411
    • Neutral endopeptidase
    • Neutral endopeptidase 24.11
    • Neutral endopeptidase, membrane-associated
    • SFE
    • Skin fibroblast elastase
    see all
  • Function
    Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids. Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond. Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9. Involved in the degradation of atrial natriuretic factor (ANF). Displays UV-inducible elastase activity toward skin preelastic and elastic fibers.
  • Sequence similarities
    Belongs to the peptidase M13 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab155720 stained overnight with Coomassie Blue.

References

ab155720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up