Overview

  • Product name
    Recombinant Human CD101 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NRPPRASAISHPLRIAVTLPESKLKVNSRSQGQELSINSNTDIECSILSR SNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFH TEKVSQD
    • Amino acids
      653 to 759
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD101 molecule
    • cell surface glycoprotein V7
    • EWI-101
    • glu-Trp-Ile EWI motif-containing protein 101
    • IGSF2
    • Immunoglobulin superfamily member 2
    • Leukocyte surface protein
    • V7
    • V7 LSB
    see all
  • Relevance
    CD101 is a disulfide-linked homodimeric type 1 glycoprotein. The peptide is comprised of 7 extracellular V-type IgSF domains. CD101 is highly expressed on monocytes, granulocytes, mucosal T cells, and on activated peripheral blood T cells. Expression is weak on resting T and B and NK cells, absent from platelets and weak or absent from most hematopoietic cell lines. CD101 is thought to play a co-stimulatory role in TCR/CD3-mediated T cell activation. Monoclonal antibodies against CD101 inhibit allogeneic T cell responses. Studies suggest that CD101 plays a major role in the activation of T cells by skin dendritic cells.
  • Cellular localization
    Cell Membrane

Images

  • ab160469 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up