Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY QGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQL KEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPD LGTDDDDKAMETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVH VLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIP LHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDP QSILLRLGQAQ
    • Molecular weight
      34 kDa including tags
    • Amino acids
      26 to 176
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.88% Sodium chloride, 99% PBS

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • AI528660
    • AI662476
    • CD 105
    • CD105
    • CD105 antigen
    • EGLN_HUMAN
    • END
    • Endoglin
    • Eng
    • FLJ41744
    • HHT1
    • ORW
    • ORW1
    • Osler Rendu Weber syndrome 1
    • RP11 228B15.2
    • S-endoglin
    • SN6
    see all
  • Function
    Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors.
  • Tissue specificity
    Endoglin is restricted to endothelial cells in all tissues except bone marrow.
  • Involvement in disease
    Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1) [MIM:187300, 108010]; also known as Osler-Rendu-Weber syndrome 1 (ORW1). HHT1 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab185385 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up