Recombinant human CD105 protein (ab54338)

Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • AccessionP17813
    • SpeciesHuman
    • SequenceETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGP SQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLV TFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQA QGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLP GHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTG EYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSL HASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEA VVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFV QVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPE GDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNII SPDLSGCTSHHHHHH
    • Amino acids26 to 584
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab54338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Purity> 95 % SDS-PAGE.
    Purity: > 95% (SDS-PAGE and visualized by Silverstain)
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    None

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in PBS or medium to a concentration not lower than 50 µg/ml.

General Info

  • Alternative names
    • AI528660
    • AI662476
    • CD 105
    • CD105
    • CD105 antigen
    • EGLN_HUMAN
    • END
    • Endoglin
    • Eng
    • FLJ41744
    • HHT1
    • ORW
    • ORW1
    • Osler Rendu Weber syndrome 1
    • RP11 228B15.2
    • S-endoglin
    • SN6
    see all
  • FunctionMajor glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors.
  • Tissue specificityEndoglin is restricted to endothelial cells in all tissues except bone marrow.
  • Involvement in diseaseDefects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1) [MIM:187300, 108010]; also known as Osler-Rendu-Weber syndrome 1 (ORW1). HHT1 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant human CD105 protein images

References for Recombinant human CD105 protein (ab54338)

ab54338 has not yet been referenced specifically in any publications.

Product Wall

The protein was dialyzed against PBS and then lyophilized.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"