Overview

  • Product name
    Recombinant Human CD11c protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSIS SRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPL SLLASVHQLQ
    • Amino acids
      114 to 223
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 95
    • 95 alpha chain
    • CD 11c
    • CD11 antigen like family member C
    • CD11 antigen-like family member C
    • CD11c
    • CD11c antigen
    • Complement component 3 receptor 4 subunit
    • CR4
    • Integrin alpha X
    • Integrin alpha X chain
    • Integrin alpha-X
    • Integrin aX
    • Integrin subunit alpha X
    • integrin, alpha X (antigen CD11C (p150), alpha polypeptide)
    • integrin, alpha X (complement component 3 receptor 4 subunit
    • ITAX_HUMAN
    • ITGAX
    • Leu M5
    • LEU M5 alpha subunit
    • Leukocyte adhesion glycoprotein p150
    • Leukocyte adhesion glycoprotein p150 95 alpha chain
    • Leukocyte adhesion receptor p150
    • Leukocyte adhesion receptor p150 95
    • Leukocyte surface antigen p150 95 alpha subunit
    • Leukocyte surface antigen p150 alpha subunit
    • Myeloid membrane antigen alpha subunit
    • p150
    • p150 95 integrin alpha chain
    • p150/95
    • SLEB6
    see all
  • Function
    Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis.
  • Tissue specificity
    Predominantly expressed in monocytes and granulocytes.
  • Sequence similarities
    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
    Contains 1 VWFA domain.
  • Domain
    The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158776 on a 12.5% SDS-PAGE stained with Coomassie Blue. Predicted MW (kDa)37.84.

References

ab158776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up