Recombinant Human CD130 (gp130) protein (ab114303)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP40189
    • SpeciesHuman
    • SequenceELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHF TIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
    • Molecular weight37 kDa including tags
    • Amino acids23 to 122

Specifications

Our Abpromise guarantee covers the use of ab114303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD130
    • CD130 antigen
    • CDw130
    • gp130
    • GP130 RAPS
    • IL 6R beta
    • IL-6 receptor subunit beta
    • IL-6R subunit beta
    • IL-6R-beta
    • IL-6RB
    • IL6 ST
    • IL6RB_HUMAN
    • IL6ST
    • Interleukin 6 receptor subunit beta
    • Interleukin receptor beta chain
    • Interleukin-6 receptor subunit beta
    • Interleukin-6 signal transducer
    • Membrane glycoprotein 130
    • Membrane glycoprotein gp130
    • Oncostatin M receptor
    • Oncostatin M receptor alpha subunit
    • Oncostatin-M receptor subunit alpha
    see all
  • FunctionSignal-transducing molecule. The receptor systems for IL6, LIF, OSM, CNTF, IL11, CTF1 and BSF3 can utilize gp130 for initiating signal transmission. Binds to IL6/IL6R (alpha chain) complex, resulting in the formation of high-affinity IL6 binding sites, and transduces the signal. Does not bind IL6. May have a role in embryonic development (By similarity). The type I OSM receptor is capable of transducing OSM-specific signaling events.
  • Tissue specificityFound in all the tissues and cell lines examined. Expression not restricted to IL6 responsive cells.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    Phosphorylation of Ser-782 down-regulates cell surface expression.
    Heavily N-glycosylated.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Recombinant Human CD130 (gp130) protein images

  • 12.5% SDS-PAGE image showing ab114303 at approx 36.63 kDa. Stained with Coomassie Blue.

References for Recombinant Human CD130 (gp130) protein (ab114303)

ab114303 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"