Recombinant human CD134 / OX40L receptor protein (Active) (ab221231)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human CD134 / OX40L receptor protein (Active)
See all CD134 / OX40L receptor proteins and peptides -
Biological activity
Immobilized Human OX40, His Tag at 2 μg/mL (100 μL/well) can bind Human OX40 Ligand, Fc Tag with a linear range of 0.5-16 ng/mL.
-
Purity
> 90 % SDS-PAGE.
Purified by Immobilized metal affinity chromatography. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSS KPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPC PPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQE TQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA -
Predicted molecular weight
22 kDa including tags -
Molecular weight information
The protein migrates as 35-45 kDa under reducing condition due to glycosylation. -
Amino acids
29 to 216 -
Tags
His tag C-Terminus -
Additional sequence information
Accession # NP_003318.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab221231 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- ACT 35
- ACT35
- ACT35 antigen
see all -
Function
Receptor for TNFSF4/OX40L/GP34. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Loaded Anti-OX40 MAb(Human IgG1) on AHC Biosensor, can bind ab221231 with an affinity constant of 6.03 nM as determined in BLI assay.
-
Loaded ab221412 on AR2G Biosensor, can bind ab221231 with an affinity constant of 0.15 μM as determined in BLI assay.
-
ab221231 on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
-
The purity of ab221231 was more than 85% and around 32-44 kDa verified by SEC-MALS.
-
Immobilized Human OX40, His Tag at 2 µg/mL (100 µL/well)can bind Mouse OX40 Ligand, Fc Tag with a linear range of 0.5-16 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab221231 has not yet been referenced specifically in any publications.