Recombinant Human CD147 protein (ab114196)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAW YKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      206 to 305

Specifications

Our Abpromise guarantee covers the use of ab114196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5A11 antigen
    • 5F7
    • BASI_HUMAN
    • Basigin
    • Basigin (Ok blood group)
    • Blood brain barrier HT7 antigen
    • Bsg
    • CD 147
    • CD147
    • CD147 antigen
    • Collagenase stimulatory factor
    • EMMPRIN
    • Extracellular matrix metalloproteinase inducer
    • Leukocyte activation antigen M6
    • M 6
    • M6
    • M6 leukocyte activation antigen
    • Neurothelin
    • OK
    • OK blood group
    • OK blood group antigen
    • TCSF
    • Tumor cell derived collagenase stimulatory factor
    • Tumor cell-derived collagenase stimulatory factor
    see all
  • Function
    Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). May target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
  • Tissue specificity
    Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane. Melanosome. Colocalizes with SLC16A1 and SLC16A8 (By similarity). Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human CD147 protein images

  • 12.5% SDS-PAGE showing ab114196 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human CD147 protein (ab114196)

ab114196 has not yet been referenced specifically in any publications.

Product Wall



I am very pleased to hear you would like to accept our offer and test ab114195 and ab114196 in a functional assay.This code will give you 1 freeprotein before the expiration date. To redeem this offer, please submit an Abreview for a functio...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up