Overview

  • Product name
    Recombinant Human CD15 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFN ISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      167 to 265

Specifications

Our Abpromise guarantee covers the use of ab114288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-FAL
    • Alpha-3-fucosyltransferase
    • ELAM 1 ligand
    • ELAM ligand fucosyltransferase
    • ELAM-1 ligand fucosyltransferase
    • ELFT
    • FCT3A
    • FUC-TIV
    • Fucosyltransferase
    • fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)
    • fucosyltransferase IV
    • fucT-IV
    • FUTIV
    • galactoside 3-L-fucosyltransferase
    • Leu M1
    • Lewis X
    • LeX
    • SSEA-1
    • stage-specific embryonic antigen 1
    see all
  • Relevance
    CD15 is a carbohydrate adhesion molecule (and not a protein) that mediates phagocytosis and chemotaxis. Synthesis is directed by FUT4 in lymphoid cells and mature granulocytes, and by FUT9 in promyelocytes and monocytes.
  • Cellular localization
    Golgi Apparatus; Membrane-bound form in trans cisternae of Golgi.

Images

  • 12.5% SDS-PAGE image showing ab114288 at approximately 36.52 kDa, stained by Commassie Blue.

References

ab114288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up