Overview

  • Product nameRecombinant Human CD15 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP22083
    • SpeciesHuman
    • SequenceITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFN ISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL
    • Molecular weight37 kDa including tags
    • Amino acids167 to 265

Specifications

Our Abpromise guarantee covers the use of ab114288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-FAL
    • Alpha-3-fucosyltransferase
    • ELAM 1 ligand
    • ELAM ligand fucosyltransferase
    • ELAM-1 ligand fucosyltransferase
    • ELFT
    • FCT3A
    • FUC-TIV
    • Fucosyltransferase
    • fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)
    • fucosyltransferase IV
    • fucT-IV
    • FUTIV
    • galactoside 3-L-fucosyltransferase
    • Leu M1
    • Lewis X
    • LeX
    • SSEA-1
    • stage-specific embryonic antigen 1
    see all
  • RelevanceCD15 is a carbohydrate adhesion molecule (and not a protein) that mediates phagocytosis and chemotaxis. Synthesis is directed by FUT4 in lymphoid cells and mature granulocytes, and by FUT9 in promyelocytes and monocytes.
  • Cellular localizationGolgi Apparatus; Membrane-bound form in trans cisternae of Golgi.

Recombinant Human CD15 protein images

  • 12.5% SDS-PAGE image showing ab114288 at approximately 36.52 kDa, stained by Commassie Blue.

References for Recombinant Human CD15 protein (ab114288)

ab114288 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"