Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTK LSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLEL LINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQ YIDTSTFPLENVLSIFLYSNSD
    • Molecular weight
      35 kDa including tags
    • Amino acids
      63 to 234
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Binds to Human CD30.

    ab157263 can be used with an enhancer to detect membrane-bound Human CD30. rhsCD153 saturates its receptor at a concentration range of 12-4000ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    Binds to Human CD30.

    ab157263 can be used with an enhancer to detect membrane-bound Human CD30. rhsCD153 saturates its receptor at a concentration range of 12-4000ng/ml.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • CD153
    • CD153 antigen
    • CD30 antigen ligand
    • CD30 L
    • CD30 ligand
    • CD30-L
    • CD30L
    • CD30LG
    • MGC138144
    • TNFL8_HUMAN
    • Tnfsf8
    • Tumor necrosis factor (ligand) superfamily member 8
    • Tumor necrosis factor ligand superfamily member 8
    see all
  • Function
    Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab157263 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up