Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL ISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRW VFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKD SGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
    • Molecular weight
      23 kDa including tags
    • Amino acids
      17 to 208
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to bind Human IgG with an estimated KD < 45 nM.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    ab167758 is lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Measured by its ability to bind Human IgG with an estimated KD < 45 nM.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water. Solubilise for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD 16
    • CD 16a
    • CD16
    • CD16a
    • CD16a antigen
    • CD16B
    • CD16b antigen
    • Fc fragment of IgG
    • Fc fragment of IgG low affinity IIIa receptor
    • Fc fragment of IgG low affinity IIIa receptor (CD16)
    • Fc fragment of IgG receptor IIIa
    • Fc fragment of IgG, low affinity III, receptor (CD16)
    • Fc fragment of IgG, low affinity III, receptor for (CD16)
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16)
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
    • Fc fragment of IgG, low affinity IIIa, receptor for
    • Fc fragment of IgG, low affinity IIIb, receptor (CD16b)
    • Fc fragment of IgG, low affinity IIIb, receptor for (CD16)
    • Fc gamma R3
    • Fc gamma receptor III 2 (CD 16)
    • Fc gamma receptor III A
    • Fc gamma receptor IIIA
    • Fc gamma receptor IIIb (CD 16)
    • Fc gamma RIII
    • Fc gamma RIII alpha
    • Fc gamma RIII beta
    • Fc gamma RIIIa
    • Fc gamma RIIIb
    • Fc of IgG
    • Fc-gamma receptor III2 (CD 16)
    • Fc-gamma receptor III2 (CD16)
    • Fc-gamma receptor IIIb (CD16)
    • Fc-gamma RIII
    • Fc-gamma RIII-alpha
    • Fc-gamma RIIIa
    • FCG 3
    • FCG3
    • FCG3A_HUMAN
    • FCgammaRIIIA
    • FCGR 3
    • FCGR 3A
    • FCGR3
    • FCGR3A
    • FCGR3A protein
    • FCGRIII
    • FCGRIII-2
    • FcR 10
    • FcR-10
    • FcR10
    • FcRIII
    • FcRIIIa
    • IGFR 3
    • IGFR3
    • IgG Fc receptor III 1
    • IgG Fc receptor III 2
    • IgG Fc receptor III-2
    • IMD20
    • immunoglobulin G Fc receptor III
    • immunoglobulin G Fc receptor III-2
    • Low affinity IIIa receptor
    • Low affinity immunoglobulin gamma Fc region receptor III A
    • Low affinity immunoglobulin gamma Fc region receptor III-A
    • Low affinity immunoglobulin gamma Fc region receptor IIIB
    • neutrophil-specific antigen NA
    see all
  • Function
    Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
  • Tissue specificity
    Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Glycosylated. Contains high mannose- and complex-type oligosaccharides.
    The soluble form is produced by a proteolytic cleavage.
  • Cellular localization
    Cell membrane. Secreted. Exists also as a soluble receptor.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167758 stained overnight with Coomassie Blue.

References

ab167758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up