Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKS VQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTI VKVFKQPSKP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      28 to 137
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activated leukocyte cell adhesion molecule
    • ALCAM
    • ALCAM protein
    • CD 166
    • CD166
    • CD166 antigen
    • CD166_HUMAN
    • FLJ3851
    • FLJ38514
    • MEMD
    • MGC71733
    see all
  • Function
    Cell adhesion molecule that binds to CD6. Involved in neurite extension by neurons via heterophilic and homophilic interactions. May play a role in the binding of T- and B-cells to activated leukocytes, as well as in interactions between cells of the nervous system.
  • Tissue specificity
    Spleen, placenta, liver, and weakly in liver. Expressed by activated T-cells, B-cells, monocytes and thymic epithelial cells. Expressed by neurons in the brain. Restricted expression in tumor cell lines. Preferentially expressed in highly metastasizing melanoma cell lines.
  • Sequence similarities
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Domain
    The CD6 binding site is located in the N-terminal Ig-like domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human CD166 protein images

  • 12.5% SDS page analysis of ab112249

References for Recombinant Human CD166 protein (ab112249)

ab112249 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up