Recombinant Human CD18 protein (ab114283)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLN FTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSP QKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLG GDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQP PFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEI GWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS NVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDC DGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCR DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKD NNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCG GPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGL QLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNND NPLFKSATTTVMNPKFAES
    • Molecular weight
      111 kDa including tags
    • Amino acids
      1 to 769

Specifications

Our Abpromise guarantee covers the use of ab114283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 95 subunit beta
    • Beta 2 (antigen CD18 (p95)
    • CD 18
    • CD18
    • Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor)
    • Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta
    • Cell surface adhesion glycoproteins LFA-1/CR3/p150
    • Complement component 3 receptor 3 and 4 subunit
    • Complement receptor C3 beta subunit
    • Complement receptor C3 subunit beta
    • Integrin beta 2
    • Integrin beta chain beta 2
    • Integrin beta-2
    • Integrin beta-2 (ITGB2)
    • Integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
    • ITB2_HUMAN
    • ITGB2
    • LAD
    • LCAMB
    • Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C
    • Leukocyte cell adhesion molecule CD18
    • LFA 1
    • LFA1
    • Lymphocyte function associated antigen 1
    • Lymphocyte function associated antigen 1 (LFA1)
    • MAC 1
    • MAC1
    • Macrophage antigen 1 (mac1) beta
    • MF17
    • MFI7
    • OTTHUMP00000115278
    • OTTHUMP00000115279
    • OTTHUMP00000115280
    • OTTHUMP00000115281
    • OTTHUMP00000115282
    see all
  • Function
    Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha-D/beta-2 is a receptor for ICAM3 and VCAM1.
  • Involvement in disease
    Defects in ITGB2 are the cause of leukocyte adhesion deficiency type 1 (LAD1) [MIM:116920]. LAD1 patients have recurrent bacterial infections and their leukocytes are deficient in a wide range of adhesion-dependent functions.
  • Sequence similarities
    Belongs to the integrin beta chain family.
    Contains 1 VWFA domain.
  • Post-translational
    modifications
    Both Ser-745 and Ser-756 become phosphorylated when T-cells are exposed to phorbol esters. Phosphorylation on Thr-758 (but not on Ser-756) allows interaction with 14-3-3 proteins.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of CD18 protein (ab114283). Stained with Coomassie Blue.

References

ab114283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Ratings

Application
Other
The effect of recombinant protein on cell viability is assessed using MTS viability determination method on cultured CHO-M2 cells incubated 42h in presence of different concentrations (45.5 – 22.7 – 11.4 – 5.7 – 2.8 – 1.4 nM) of rCD18.

CONCLUSION
The viability is similar for the different concentration of rCD18. It doesn’t affect cell viability.
Username

Abcam user community

Verified customer

Submitted Aug 26 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up