Recombinant Human CD19 protein (ab114202)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSP SGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
    • Molecular weight
      36 kDa including tags
    • Amino acids
      98 to 187

Specifications

Our Abpromise guarantee covers the use of ab114202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Antibody deficiency due to defect in CD19, included
    • AW495831
    • B lymphocyte antigen CD19
    • B lymphocyte surface antigen B4
    • B-lymphocyte antigen CD19
    • B-lymphocyte surface antigen B4
    • B4
    • CD19
    • CD19 antigen
    • CD19 molecule
    • Cd19 protein
    • CD19_HUMAN
    • CVID3
    • Differentiation antigen CD19
    • Leu 12
    • Leu-12
    • Leu12
    • MGC109570
    • MGC12802
    • T-cell surface antigen Leu-12
    see all
  • Function
    Assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
  • Involvement in disease
    Defects in CD19 are the cause of immunodeficiency common variable type 3 (CVID3) [MIM:613493]; also called antibody deficiency due to CD19 defect. CVID3 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine upon DNA damage, probably by ATM or ATR. Phosphorylated on tyrosine following B-cell activation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114202 on 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting Abcam.

For ab114202, you get 10ug of total protein, and the current lot is supplied at a concentration of 0.3mg/ml, which would mean that you would receive 33.3ul total volume.

I do apologize for the confusi...

Read More

Thank you for contacting us.

I have contacted the supplying lab for the specific information you had mentioned.

I also checked internally and was told that the material safety datasheet is what would help you most. I have attached ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up