Recombinant Human CD19 protein (ab114202)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP15391
    • SpeciesHuman
    • SequenceQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSP SGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
    • Molecular weight36 kDa including tags
    • Amino acids98 to 187

Specifications

Our Abpromise guarantee covers the use of ab114202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Antibody deficiency due to defect in CD19, included
    • AW495831
    • B lymphocyte antigen CD19
    • B lymphocyte surface antigen B4
    • B-lymphocyte antigen CD19
    • B-lymphocyte surface antigen B4
    • B4
    • CD19
    • CD19 antigen
    • CD19 molecule
    • Cd19 protein
    • CD19_HUMAN
    • CVID3
    • Differentiation antigen CD19
    • Leu 12
    • Leu-12
    • Leu12
    • MGC109570
    • MGC12802
    • T-cell surface antigen Leu-12
    see all
  • FunctionAssembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
  • Involvement in diseaseDefects in CD19 are the cause of immunodeficiency common variable type 3 (CVID3) [MIM:613493]; also called antibody deficiency due to CD19 defect. CVID3 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similaritiesContains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine upon DNA damage, probably by ATM or ATR. Phosphorylated on tyrosine following B-cell activation.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD19 protein images

  • ab114202 on 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human CD19 protein (ab114202)

ab114202 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting Abcam.

For ab114202, you get 10ug of total protein, and the current lot is supplied at a concentration of 0.3mg/ml, which would mean that you would receive 33.3ul total volume.

I do apologize for the confusi...

Read More

Thank you for contacting us.

I have contacted the supplying lab for the specific information you had mentioned.

I also checked internally and was told that the material safety datasheet is what would help you most. I have attached ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"