Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP29016
    • SpeciesHuman
    • SequenceMLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWL DDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQ DFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCV PSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQ RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQL GDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTS IGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP
    • Molecular weight63 kDa including tags
    • Amino acids1 to 333

Specifications

Our Abpromise guarantee covers the use of ab114933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • A1 domain
    • CD1
    • CD1A
    • CD1b
    • CD1b antigen
    • CD1B antigen b polypeptide
    • CD1b molecule
    • CD1B_HUMAN
    • Cortical thymocyte antigen CD1A
    • Cortical thymocyte antigen CD1B
    • Differentiation antigen CD1 alpha 3
    • hTa1 thymocyte antigen
    • Ly38
    • Ly38; T cell surface glycoprotein CD1a
    • MGC125990
    • MGC125991
    • R1
    • T-cell surface glycoprotein CD1b
    • T6/Leu6
    • Thymocite antigen CD1B
    see all
  • FunctionAntigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
  • Tissue specificityExpressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
  • Sequence similaritiesContains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localizationCell membrane. Endosome membrane. Lysosome membrane. Subject to intracellular trafficking between the cell membrane, endosomes and lysosomes. Localizes to cell surface lipid rafts.
  • Information by UniProt

Recombinant Human CD1b protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114933 at approximately 62.70kDa.

References for Recombinant Human CD1b protein (ab114933)

ab114933 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"