Overview

  • Product name
    Recombinant Human CD1c protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGK SPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTET VYNLIRSTC
    • Molecular weight
      38 kDa including tags
    • Amino acids
      77 to 185

Specifications

Our Abpromise guarantee covers the use of ab114935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BDCA1
    • CD1
    • CD1A
    • CD1c
    • CD1c antigen
    • CD1C antigen c polypeptide
    • CD1c molecule
    • CD1C_HUMAN
    • Cortical thymocyte antigen CD1C
    • Differentiation antigen CD1 alpha 3
    • R7
    • T cell surface glycoprotein CD1c
    • T-cell surface glycoprotein CD1c
    see all
  • Function
    Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
  • Tissue specificity
    Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane. Endosome membrane. Subject to intracellular trafficking between the cell membrane and endosomes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab11435 at approximately 37.62kDa.

References

ab114935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up