Overview

  • Product nameRecombinant Human CD1c protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP29017
    • SpeciesHuman
    • SequenceSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGK SPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTET VYNLIRSTC
    • Molecular weight38 kDa including tags
    • Amino acids77 to 185

Specifications

Our Abpromise guarantee covers the use of ab114935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BDCA1
    • CD1
    • CD1A
    • CD1c
    • CD1c antigen
    • CD1C antigen c polypeptide
    • CD1c molecule
    • CD1C_HUMAN
    • Cortical thymocyte antigen CD1C
    • Differentiation antigen CD1 alpha 3
    • R7
    • T cell surface glycoprotein CD1c
    • T-cell surface glycoprotein CD1c
    see all
  • FunctionAntigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
  • Tissue specificityExpressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
  • Sequence similaritiesContains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localizationCell membrane. Endosome membrane. Subject to intracellular trafficking between the cell membrane and endosomes.
  • Information by UniProt

Recombinant Human CD1c protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab11435 at approximately 37.62kDa.

References for Recombinant Human CD1c protein (ab114935)

ab114935 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"