Recombinant Human CD1d protein (ab114936)

Overview

  • Product nameRecombinant Human CD1d protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP15813
    • SpeciesHuman
    • SequenceMGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWL GELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVK EFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWE PTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQP GDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
    • Molecular weight63 kDa including tags
    • Amino acids1 to 335

Specifications

Our Abpromise guarantee covers the use of ab114936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen-presenting glycoprotein CD1d
    • CD1.1
    • CD1A
    • CD1d
    • CD1D antigen
    • CD1D antigen d polypeptide
    • CD1d molecule
    • CD1D_HUMAN
    • Cd1d1
    • differentiation antigen CD1 alpha 3
    • HMC class I antigen like glycoprotein CD1D
    • Ly 38
    • MGC34622
    • R3
    • R3G1
    • T cell surface glycoprotein CD1d
    • Thymocyte antigen CD1D
    see all
  • FunctionAntigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
  • Tissue specificityExpressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
  • Sequence similaritiesContains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localizationCell membrane. Endosome membrane. Lysosome membrane. Subject to intracellular trafficking between the cell membrane, endosomes and lysosomes.
  • Information by UniProt

Recombinant Human CD1d protein images

  • ab114936 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD1d protein (ab114936)

ab114936 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry.

You stated your interest in a CD1d antibody however the product you mentioned, ab114936, is a recombinant CD1d protein. The coomassie stained gel shown there is the protein product rather than a western blot.
...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"