Recombinant Human CD1d protein (ab114936)

Overview

  • Product name
    Recombinant Human CD1d protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWL GELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVK EFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWE PTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQP GDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 335

Specifications

Our Abpromise guarantee covers the use of ab114936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen-presenting glycoprotein CD1d
    • CD1.1
    • CD1A
    • CD1d
    • CD1D antigen
    • CD1D antigen d polypeptide
    • CD1d molecule
    • CD1D_HUMAN
    • Cd1d1
    • differentiation antigen CD1 alpha 3
    • HMC class I antigen like glycoprotein CD1D
    • Ly 38
    • MGC34622
    • R3
    • R3G1
    • T cell surface glycoprotein CD1d
    • Thymocyte antigen CD1D
    see all
  • Function
    Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
  • Tissue specificity
    Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane. Endosome membrane. Lysosome membrane. Subject to intracellular trafficking between the cell membrane, endosomes and lysosomes.
  • Information by UniProt

Images

  • ab114936 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your enquiry.

You stated your interest in a CD1d antibody however the product you mentioned, ab114936, is a recombinant CD1d protein. The coomassie stained gel shown there is the protein product rather than a western blot.
...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up