Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESK TLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL LAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKME SLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF AFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLT ETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
    • Amino acids
      1 to 297
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APY
    • ATOPY
    • B lymphocyte antigen CD20
    • B Lymphocyte Cell Surface Antigen B1
    • B-lymphocyte antigen CD20
    • B-lymphocyte cell-surface antigen B1
    • B-lymphocyte surface antigen B1
    • B1
    • Bp 35
    • Bp35
    • CD 20
    • CD20
    • CD20 antigen
    • CD20 receptor
    • CD20_HUMAN
    • CVID5
    • Fc epsilon receptor I beta chain
    • Fc Fragment of IgE high affinity I receptor for beta polypeptide
    • FCER1B
    • High affinity immunoglobulin epsilon receptor subunit beta
    • IgE Fc receptor subunit beta
    • IGEL
    • IGER
    • IGHER
    • LEU 16
    • LEU16
    • leukocyte surface antigen Leu 16
    • Leukocyte surface antigen Leu-16
    • Ly44
    • Membrane spanning 4 domains A1
    • Membrane spanning 4 domains subfamily A member 2
    • Membrane-spanning 4-domains subfamily A member 1
    • MGC3969
    • MS4A1
    • MS4A2
    • S7
    see all
  • Function
    This protein may be involved in the regulation of B-cell activation and proliferation.
  • Tissue specificity
    Expressed on B-cells.
  • Involvement in disease
    Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5) [MIM:613495]; also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities
    Belongs to the MS4A family.
  • Post-translational
    modifications
    Phosphorylated. Might be functionally regulated by protein kinase(s).
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158047 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up