Recombinant Human CD200R protein (ab112432)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLCPWRTANLGLLLILTIFLVAEAEGAAQPNNSLMLQTSKENHALASSSL CMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLIIITWEII LRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTVAITHD GYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAH ISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSL YIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKT ESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL
    • Molecular weight
      64 kDa including tags
    • Amino acids
      1 to 348

Specifications

Our Abpromise guarantee covers the use of ab112432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD 200R
    • CD200 cell surface glycoprotein receptor
    • CD200 receptor 1
    • Cd200r1
    • Cell surface glycoprotein CD200 receptor 1
    • Cell surface glycoprotein OX2 receptor
    • Cell surface glycoprotein OX2 receptor 1
    • cell surface glycoprotein receptor CD200
    • CRTR 2
    • CRTR2
    • HCRTR2
    • MO2R1_HUMAN
    • MOX2 receptor
    • MOX2R
    • OX2R
    see all
  • Function
    Receptor for the CD200/OX2 cell surface glycoprotein. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.
  • Tissue specificity
    Expressed in granulocytes, monocytes, most T cells, neutrophils, basophils and a subset of NK, NKT and B cells (at protein level). Expressed in bone marrow, lymph nodes, spleen, lung, liver, spinal cord, kidney. Expressed in monocyte-derived dendritic and mast cells.
  • Sequence similarities
    Belongs to the CD200R family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    The mature form of isoform 2 and/or isoform 4 starts at sequence position 27 of the corresponding isoform.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Recombinant Human CD200R protein images

  • ab112432 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CD200R protein (ab112432)

ab112432 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up