Recombinant Human CD200R protein (ab153597)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTV AITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAG
    • Amino acids
      73 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 200R
    • CD200 cell surface glycoprotein receptor
    • CD200 receptor 1
    • Cd200r1
    • Cell surface glycoprotein CD200 receptor 1
    • Cell surface glycoprotein OX2 receptor
    • Cell surface glycoprotein OX2 receptor 1
    • cell surface glycoprotein receptor CD200
    • CRTR 2
    • CRTR2
    • HCRTR2
    • MO2R1_HUMAN
    • MOX2 receptor
    • MOX2R
    • OX2R
    see all
  • Function
    Receptor for the CD200/OX2 cell surface glycoprotein. Also binds to HHV-8 K14 viral CD200 homolog with identical affinity and kinetics as the host CD200.
  • Tissue specificity
    Expressed in granulocytes, monocytes, most T cells, neutrophils, basophils and a subset of NK, NKT and B cells (at protein level). Expressed in bone marrow, lymph nodes, spleen, lung, liver, spinal cord, kidney. Expressed in monocyte-derived dendritic and mast cells.
  • Sequence similarities
    Belongs to the CD200R family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    The mature form of isoform 2 and/or isoform 4 starts at sequence position 27 of the corresponding isoform.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab153597 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up