Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGS ILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTT
    • Amino acids
      156 to 253
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD229
    • Cell surface molecule Ly-9
    • Cell surface molecule Ly9
    • hly9
    • LY 9
    • Ly9
    • LY9_HUMAN
    • Lymphocyte antigen 9
    • mLY9
    • Signaling lymphocytic activation molecule 3
    • SLAM family member 3
    • SLAMF3
    • T lymphocyte surface antigen Ly9 precursor
    • T-lymphocyte surface antigen Ly-9
    see all
  • Function
    May participate in adhesion reactions between T lymphocytes and accessory cells by homophilic interaction.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158838 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up