Recombinant Human CD229 protein (His tag) (ab219445)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ADLKDSAPTVVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKE NVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEVTTEE EFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPR EPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTD PGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKVVWLFNTSIISKERE EAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEAS SVTSMTHVTLLIYRRLRKPKITWSLRHSEDGICRISLTCSVEDGGNTVMY TWTPLQKEAVVSQGESHLNVSWRSSENHPNLTCTASNPVSRSSHQFLSEN ICSGPERNTKHHHHHH
    • Molecular weight
      46 kDa including tags
    • Amino acids
      48 to 454
    • Tags
      His tag C-Terminus
    • Additional sequence information
      extracellular domain (NP_002339).

Specifications

Our Abpromise guarantee covers the use of ab219445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    ab219445 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names
    • CD229
    • Cell surface molecule Ly-9
    • Cell surface molecule Ly9
    • hly9
    • LY 9
    • Ly9
    • LY9_HUMAN
    • Lymphocyte antigen 9
    • mLY9
    • Signaling lymphocytic activation molecule 3
    • SLAM family member 3
    • SLAMF3
    • T lymphocyte surface antigen Ly9 precursor
    • T-lymphocyte surface antigen Ly-9
    see all
  • Function
    May participate in adhesion reactions between T lymphocytes and accessory cells by homophilic interaction.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219445 (3µg).   

References

ab219445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up