Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRA EQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTK LRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQ LVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAP GEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSA ESMGPDSRPDPDGRLPTPSAPLHS
    • Molecular weight
      33 kDa including tags
    • Amino acids
      48 to 321
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its binding ability in a functional ELISA. Immobilized ab167725 at 2 µg/ml (100 µl/well) can bind Human IgE with a linear range of 0.01-1.2 µg/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    Measured by its binding ability in a functional ELISA. Immobilized ab167725 at 2 µg/ml (100 µl/well) can bind Human IgE with a linear range of 0.01-1.2 µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 99% PBS
    Note: Normally Mannitol or Trehalose are added as protectants before lyophilization.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 10µl sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Blast 2
    • BLAST-2
    • Blast2
    • C type lectin domain family 4 member J
    • C-type lectin domain family 4 member J
    • C-type lectin domain family 4, member J
    • CD 23
    • CD 23A
    • CD23
    • CD23 antigen
    • CD23A
    • CLEC 4J
    • CLEC4J
    • Fc epsilon receptor II
    • Fc epsilon RII
    • Fc fragment of IgE low affinity II receptor for
    • Fc fragment of IgE receptor II
    • Fc fragment of IgE, low affinity II, receptor for (CD23)
    • Fc of IgE, low affinity II, receptor for (CD23)
    • Fc receptor IgE low affinity II alpha polypeptide
    • Fc receptor, IgE, low affinity II, alpha polypeptide, isoform CRA_a
    • Fc-epsilon-RII
    • FCE 2
    • FCE2
    • FCER 2
    • Fcer2
    • FCER2_HUMAN
    • FCER2A
    • FceRII
    • IgE binding factor
    • IgE receptor lymphocyte
    • IgE-binding factor
    • IGEBF
    • Immunoglobulin E binding factor
    • Immunoglobulin E receptor, low affinity II
    • Immunoglobulin E-binding factor
    • Immunoglobulin epsilon chain
    • LEUKOCYTE ANTIGEN CD23
    • Low Affinity IgE Receptor
    • Low affinity immunoglobulin epsilon Fc receptor
    • Low affinity immunoglobulin epsilon Fc receptor membrane bound form
    • Low affinity immunoglobulin epsilon Fc receptor soluble form
    • Ly-42
    • Ly42
    • Lymphocyte antigen CD23
    • Lymphocyte IgE receptor
    • MGC93219
    see all
  • Function
    This receptor has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Cell membrane. Secreted. Also exists as a soluble excreted form.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab167725 stained overnight with Coomassie Blue.

References

ab167725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up