Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFEDTTQSLKQLEERAARNVSQV SKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQ ADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKW INFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHT GSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGR WNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSA PLHS
    • Molecular weight
      34 kDa including tags
    • Amino acids
      48 to 321

Specifications

Our Abpromise guarantee covers the use of ab169840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab169840 may be used for in vitro human CD23-integrin chain mediated monocyte cytokine regulation study with this protein as either coating matrix protein or soluble factor. ab169840 may be used for protein-protein interaction assay development. ab169840 may be used as antigen for specific antibody production.
  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified. Sterile-filtered.
  • Form
    Liquid
  • Additional notes
    ab169840 may be used for in vitro human CD23-integrin chain mediated monocyte cytokine regulation study with this protein as either coating matrix protein or soluble factor. ab169840 may be used for protein-protein interaction assay development. ab169840 may be used as antigen for specific antibody production.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituents: Potassium chloride, 0.32% Tris HCl, EDTA, Glycerol, Sodium chloride
    Note: Also contains DTT and Arginine.

General Info

  • Alternative names
    • Blast 2
    • BLAST-2
    • Blast2
    • C type lectin domain family 4 member J
    • C-type lectin domain family 4 member J
    • C-type lectin domain family 4, member J
    • CD 23
    • CD 23A
    • CD23
    • CD23 antigen
    • CD23A
    • CLEC 4J
    • CLEC4J
    • Fc epsilon receptor II
    • Fc epsilon RII
    • Fc fragment of IgE low affinity II receptor for
    • Fc fragment of IgE receptor II
    • Fc fragment of IgE, low affinity II, receptor for (CD23)
    • Fc of IgE, low affinity II, receptor for (CD23)
    • Fc receptor IgE low affinity II alpha polypeptide
    • Fc receptor, IgE, low affinity II, alpha polypeptide, isoform CRA_a
    • Fc-epsilon-RII
    • FCE 2
    • FCE2
    • FCER 2
    • Fcer2
    • FCER2_HUMAN
    • FCER2A
    • FceRII
    • IgE binding factor
    • IgE receptor lymphocyte
    • IgE-binding factor
    • IGEBF
    • Immunoglobulin E binding factor
    • Immunoglobulin E receptor, low affinity II
    • Immunoglobulin E-binding factor
    • Immunoglobulin epsilon chain
    • LEUKOCYTE ANTIGEN CD23
    • Low Affinity IgE Receptor
    • Low affinity immunoglobulin epsilon Fc receptor
    • Low affinity immunoglobulin epsilon Fc receptor membrane bound form
    • Low affinity immunoglobulin epsilon Fc receptor soluble form
    • Ly-42
    • Ly42
    • Lymphocyte antigen CD23
    • Lymphocyte IgE receptor
    • MGC93219
    see all
  • Function
    This receptor has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Cell membrane. Secreted. Also exists as a soluble excreted form.
  • Information by UniProt

References

ab169840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up