Overview

  • Product nameRecombinant Human CD239 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP50895
    • SpeciesHuman
    • SequenceEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASA EMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA
    • Molecular weight37 kDa including tags
    • Amino acids32 to 131

Specifications

Our Abpromise guarantee covers the use of ab116800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen identified by monoclonal antibody F8
    • AU
    • Auberger B antigen
    • B CAM cell surface glycoprotein
    • B cell adhesion molecule
    • B-CAM cell surface glycoprotein
    • Basal cell adhesion molecule
    • Basal cell adhesion molecule (Lu and Au blood groups)
    • Basal cell adhesion molecule (Lutheran blood group)
    • Basal cell adhesion molecule Lu and Au blood groups
    • Basal cell adhesion molecule Lutheran blood group
    • Bcam
    • BCAM_HUMAN
    • CD239
    • CD239 antigen
    • F8/G253 antigen
    • Glycoprotein 95kDa
    • LU
    • Lutheran
    • Lutheran antigen
    • Lutheran blood group (Auberger b antigen included)
    • Lutheran blood group Auberger b antigen included
    • Lutheran blood group glycoprotein
    • MSK19
    see all
  • FunctionLaminin alpha-5 receptor. May mediate intracellular signaling.
  • Tissue specificityWide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.
  • Sequence similaritiesContains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Developmental stageIs under developmental control in liver and may also be regulated during differentiation in other tissues. Up-regulated following malignant transformation in some cell types.
  • Post-translational
    modifications
    Epinephrine-stimulated phosphorylation of Ser-621 by PKA enhances adhesion to laminin.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD239 protein images

  • 12.5% SDS-PAGE showing ab116800 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CD239 protein (ab116800)

ab116800 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"