Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNP TNATTKAAGGALQSTASLFVVSLSLLHLYS
    • Amino acids
      1 to 80
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 24
    • CD24
    • CD24 antigen
    • CD24 antigen (small cell lung carcinoma cluster 4 antigen)
    • CD24 molecule
    • CD24_HUMAN
    • CD24A
    • FLJ22950
    • FLJ43543
    • GPI linked surface mucin
    • Heat stable antigen
    • HSA
    • MGC75043
    • Nectadrin
    • Signal transducer CD24
    • Small cell lung carcinoma cluster 4 antigen
    see all
  • Function
    Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells.
  • Tissue specificity
    B-cells. Expressed in a number of B-cell lines including P32/SH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.
  • Involvement in disease
    Genetic variations in CD24 are associated with susceptibility to multiple sclerosis (MS) [MIM:126200]. A multifactorial, inflammatory, demyelinating disease of the central nervous system. Sclerotic lesions are characterized by perivascular infiltration of monocytes and lymphocytes and appear as indurated areas in pathologic specimens (sclerosis in plaques). The pathological mechanism is regarded as an autoimmune attack of the myelin sheat, mediated by both cellular and humoral immunity. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia and bladder dysfunction. Genetic and environmental factors influence susceptibility to the disease. Note=Polymorphisms in CD24 may act as a genetic modifier for susceptibility and progression of MS in some populations, perhaps by affecting the efficiency of CD24 expression on the cell surface.
  • Sequence similarities
    Belongs to the CD24 family.
  • Post-translational
    modifications
    Extensively O-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158052 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up