Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLV KDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITA NAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVSE MLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQED YRKPEPACSP
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 260

Specifications

Our Abpromise guarantee covers the use of ab114342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 27
    • CD27
    • CD27 antigen
    • CD27 molecule
    • CD27_HUMAN
    • CD27L receptor
    • LPFS2
    • MGC20393
    • OTTHUMP00000238557
    • S152
    • T cell activation antigen CD27
    • T cell antivation antigen S152
    • T-cell activation antigen CD27
    • T14
    • TNFRSF 7
    • TNFRSF7
    • TNFSF7
    • Tp 55
    • Tp55
    • Tumor necrosis factor receptor superfamily member 7
    see all
  • Function
    Receptor for CD70/CD27L. May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1.
  • Tissue specificity
    Found in most T-lymphocytes.
  • Sequence similarities
    Contains 3 TNFR-Cys repeats.
  • Post-translational
    modifications
    Phosphorylated and O-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human CD27 protein images

  • ab114342 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CD27 protein (ab114342)

ab114342 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up