Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSRE FRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQ NLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPS KPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPG PTRKHYQPYAPPRDFAAYRS
    • Amino acids
      1 to 220
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 28
    • CD28
    • CD28 antigen
    • CD28 molecule
    • CD28_HUMAN
    • MGC138290
    • T cell antigen CD28
    • T cell specific surface glycoprotein
    • T cell specific surface glycoprotein CD28
    • T-cell-specific surface glycoprotein CD28
    • TP44
    see all
  • Function
    Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.
  • Tissue specificity
    Expressed in T-cells and plasma cells, but not in less mature B-cells.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158053 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up