Recombinant Human CD3 epsilon protein (ab167755)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDD KNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMD
    • Molecular weight
      13 kDa including tags
    • Amino acids
      23 to 126
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    ab167755 is lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Additional notes

    For long term storage, the product should be stored in lyophilized state at -20°C or lower.
    No activity loss is observed after storage at: 4-8°C for 12 months in lyophilized state.
    No activity loss is observed after storage at: -70°C for 3 months under sterile conditions after reconstitution.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD3 epsilon
    • CD3e
    • CD3E antigen epsilon polypeptide
    • CD3e antigen epsilon polypeptide (TiT3 complex)
    • CD3E antigen, epsilon subunit
    • CD3e molecule epsilon
    • CD3e molecule, epsilon (CD3 TCR complex)
    • CD3e molecule, epsilon (CD3-TCR complex)
    • CD3E_HUMAN
    • IMD18
    • T cell antigen receptor complex epsilon subunit of T3
    • T cell surface antigen T3/Leu 4 epsilon chain
    • T cell surface glycoprotein CD3 epsilon chain
    • T-cell surface antigen T3/Leu-4 epsilon chain
    • T-cell surface glycoprotein CD3 epsilon chain
    • T3E
    • TCRE
    see all
  • Function
    The CD3 complex mediates signal transduction.
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167755 stained overnight with Coomassie Blue.

References

ab167755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up