Recombinant Human CD3 zeta protein (ab112263)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20963
    • SpeciesHuman
    • SequenceMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALF LRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP QRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR
    • Molecular weight44 kDa including tags
    • Amino acids1 to 164
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 4930549J05Rik
    • A430104F18Rik
    • AW552088
    • CD247
    • CD247 antigen
    • Cd247 molecule
    • Cd3
    • CD3 antigen, zeta polypeptide, isoform CRA_b
    • CD3 antigen, zeta subunit
    • CD3-eta
    • CD3H
    • CD3Q
    • Cd3z
    • CD3Z antigen zeta polypeptide (TiT3 complex)
    • CD3Z_HUMAN
    • CD3zeta
    • CD3zeta chain
    • MGC140430
    • T cell receptor T3 zeta chain
    • T cell surface glycoprotein CD3 zeta chain
    • T-cell antigen receptor complex, zeta subunit of CD3
    • T-cell receptor T3 zeta chain
    • T-cell surface glycoprotein CD3 zeta chain
    • T3z
    • TCR zeta chain
    • TCRk
    • TCRZ
    • TCRzeta
    see all
  • FunctionProbable role in assembly and expression of the TCR complex as well as signal transduction upon antigen triggering.
  • Involvement in diseaseDefects in CD247 are the cause of immunodeficiency due to defect in CD3-zeta (CD3ZID) [MIM:610163]. An immunological deficiency characterized by T-cells impaired immune response to alloantigens, tetanus toxoid and mitogens.
  • Sequence similaritiesBelongs to the CD3Z/FCER1G family.
    Contains 3 ITAM domains.
  • DomainThe ITAM domains mediate interaction with SHB.
  • Post-translational
    modifications
    Phosphorylated on Tyr residues after T-cell receptor triggering.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD3 zeta protein images

  • ab112263 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD3 zeta protein (ab112263)

ab112263 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"