Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCE PDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPA
    • Molecular weight
      38 kDa including tags
    • Amino acids
      21 to 133
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD 30
    • CD30
    • CD30 antigen
    • CD30L receptor
    • Cytokine receptor CD30
    • D1S166E
    • KI 1
    • KI 1 antigen
    • Ki-1 antigen
    • KI1
    • Lymphocyte activation antigen CD30
    • TNFRSF 8
    • Tnfrsf8
    • TNR8_HUMAN
    • Tumor necrosis factor receptor superfamily member 8
    see all
  • Function
    Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
  • Sequence similarities
    Contains 6 TNFR-Cys repeats.
  • Post-translational
    modifications
    Phosphorylated on serine and tyrosine residues.
  • Cellular localization
    Cytoplasm and Cell membrane.
  • Information by UniProt

Recombinant Human CD30 protein images

  • ab112265 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD30 protein (ab112265)

ab112265 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up