Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCE PDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPA
    • Molecular weight
      38 kDa including tags
    • Amino acids
      21 to 133
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD 30
    • CD30
    • CD30 antigen
    • CD30L receptor
    • Cytokine receptor CD30
    • D1S166E
    • KI 1
    • KI 1 antigen
    • Ki-1 antigen
    • KI1
    • Lymphocyte activation antigen CD30
    • TNFRSF 8
    • Tnfrsf8
    • TNR8_HUMAN
    • Tumor necrosis factor receptor superfamily member 8
    see all
  • Function
    Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
  • Sequence similarities
    Contains 6 TNFR-Cys repeats.
  • Post-translational
    modifications
    Phosphorylated on serine and tyrosine residues.
  • Cellular localization
    Cytoplasm and Cell membrane.
  • Information by UniProt

Images

  • ab112265 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up