Recombinant Human CD300 antigen protein (ab161408)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWLPWALLLLWVPGCFALSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWC RPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGT YWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPP VSSTTLFAVGATHSASIQEETEEVVNSQLPLLLSLLALLLLLLVGASLLA WRMFQKWIKAGDHSELSQNPKQAATQSELHYANLELLMWPLQEKPAPPRE VEVEYSTVASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRKT
    • Amino acids
      1 to 299
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD300 antigen-like family member A
    • CD300a
    • CD300a antigen
    • CD300a molecule
    • CLM-8
    • CLM8_HUMAN
    • CMRF 35 H9
    • CMRF-35-H9
    • CMRF35-H
    • CMRF35-H9
    • CMRF35-like molecule 8
    • CMRF35H
    • CMRF35H leukocyte immunoglobulin like receptor
    • CMRF35H9
    • IgSF12
    • Immunoglobulin superfamily member 12
    • Inhibitory receptor protein 60
    • IRC1
    • IRC1/IRC2
    • IRC2
    • IRp60
    • Leukocyte membrane antigen
    • Mast cell derived paired immunoglobulin like receptor 1
    • NK inhibitory receptor
    • Polymeric immunoglobulin receptor 4
    see all
  • Function
    Inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation.
  • Tissue specificity
    Expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes.
  • Sequence similarities
    Belongs to the CD300 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab161408 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up