Recombinant Human CD300e protein (denatured) (ab187433)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSLKGPGSVTGTAGDSLTVWCQYESMYKG YNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNL NEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPP IFLVVNPGRNLSTGEVLTQNSGFRLSSPH
    • Molecular weight
      20 kDa including tags
    • Amino acids
      18 to 173
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Extracellular domain. (NCBI Accession No.: NP_852114)

Specifications

Our Abpromise guarantee covers the use of ab187433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • CD300 antigen like family member E
    • CD300 antigen-like family member E
    • CD300e
    • CD300e antigen
    • CD300e molecule
    • CD300LE
    • CLM 2
    • CLM-2
    • CLM2
    • CLM2_HUMAN
    • CMRF35 A5
    • CMRF35 like molecule 2
    • CMRF35-A5
    • CMRF35-like molecule 2
    • CMRF35A5
    • Immune receptor expressed on myeloid cells 2
    • IREM 2
    • IREM-2
    • IREM2
    • PIgR 2
    • PIgR-2
    • PIgR2
    • Poly Ig receptor 2
    • Poly-Ig receptor 2
    • Polymeric immunoglobulin receptor 2
    see all
  • Function
    Probably acts as an activating receptor.
  • Tissue specificity
    Present on the surface of mature hematopoietic cells of the monocyte and myeloid lineages (at protein level).
  • Sequence similarities
    Belongs to the CD300 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab187433.

References

ab187433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up