Recombinant Human CD300LB protein (ab165217)

Overview

  • Product name
    Recombinant Human CD300LB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCRRCKPELGQNFQSASGICICHWLQIRRTRSREGRAMWLPPALLLLSLS GCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIE TRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDL GTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILL ILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT
    • Amino acids
      1 to 238
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD_antigen=CD300b
    • CD300 antigen-like family member B
    • CD300 molecule-like family member b
    • CD300B
    • CLM 7
    • CLM7
    • CLM7_HUMAN
    • CMRF35 A2
    • CMRF35-like molecule 7
    • CMRF35A2
    • Immune receptor expressed on myeloid cells 3
    • IREM 3
    • IREM3
    • Leukocyte mono-Ig-like receptor 5
    • LMIR5
    • TREM 5
    • TREM5
    • Triggering receptor expressed on myeloid cells 5
    • UNQ2530/PRO6029
    see all
  • Cellular localization
    Cell Membrane

Images

  • ab165217 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up