Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPT HTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQ EGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGD YHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVDHHHHHH
    • Molecular weight
      22 kDa including tags
    • Amino acids
      34 to 219
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • CD32
    • CD32A
    • CD32B
    • CD32C
    • CDw32
    • Fc fragment of IgG low affinity IIa receptor
    • Fc fragment of IgG low affinity IIa receptor for (CD32)
    • Fc fragment of IgG low affinity IIb receptor
    • Fc fragment of IgG low affinity IIb receptor for (CD32)
    • Fc fragment of IgG low affinity IIc receptor
    • Fc fragment of IgG low affinity IIc receptor for (CD32)
    • Fc fragment of IgG, low affinity II, receptor for (CD32)
    • Fc fragment of IgG, low affinity IIa, receptor (CD32)
    • Fc fragment of IgG, low affinity IIb, receptor (CD32)
    • Fc gamma receptor IIB
    • Fc gamma receptor IIC
    • Fc gamma RII a
    • Fc gamma RII b
    • Fc gamma RII c
    • Fc gamma RIIb
    • Fc gamma RIIc
    • Fc receptor, IgG, low affinity IIb
    • Fc-gamma RII-a
    • Fc-gamma RII-b
    • Fc-gamma RII-c
    • Fc-gamma-RIIa
    • FC-gamma-RIIB
    • Fc-GAMMA-RIIC
    • Fc[g]RII
    • FCG2
    • FCG2A_HUMAN
    • FcGR
    • FCGR2
    • FCGR2A
    • FCGR2A1
    • FCGR2B
    • FCGR2C
    • Fcgr3
    • Fcgr3a
    • FcgRII
    • Fcr-2
    • Fcr-3
    • FCRII
    • FcRII a
    • FcRII b
    • FcRII c
    • FcRII-a
    • FcRIIC
    • IGFR2
    • IgG Fc receptor II a
    • IgG Fc receptor II b
    • IgG Fc receptor II beta
    • IgG Fc receptor II c
    • IgG Fc receptor II-a
    • IgG Fc receptor II-b
    • IgG Fc receptor II-c
    • Immunoglobulin G Fc receptor II
    • Immunoglobulin G Fc receptor II c
    • Low affinity immunoglobulin gamma Fc region receptor II
    • Low affinity immunoglobulin gamma Fc region receptor II-a
    • Low affinity immunoglobulin gamma Fc region receptor II-b
    • Low affinity immunoglobulin gamma Fc region receptor II-c
    • Ly-17
    • Ly-m20
    • LyM-1
    • Lymphocyte antigen 17
    see all
  • Function
    Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens.
  • Tissue specificity
    Found on monocytes, neutrophils and eosinophil platelets.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab151359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up