Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFSLDNNGTATPELPTQGTFSNV STNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSV YGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTS LATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEF KKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTE ISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
    • Molecular weight
      31 kDa including tags
    • Amino acids
      32 to 290
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_001764

Specifications

Our Abpromise guarantee covers the use of ab182830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab182830 was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • CD34
    • CD34 antigen
    • CD34 molecule
    • CD34_HUMAN
    • Cluster designation 34
    • Hematopoietic progenitor cell antigen CD34
    • HPCA1
    • Mucosialin
    • OTTHUMP00000034733
    • OTTHUMP00000034734
    see all
  • Function
    Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.
  • Tissue specificity
    Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
  • Sequence similarities
    Belongs to the CD34 family.
  • Developmental stage
    On early hematopoietic progenitor cells.
  • Post-translational
    modifications
    Highly glycosylated.
    Phosphorylated on serine residues by PKC.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab182830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up