Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDS RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
    • Molecular weight
      37 kDa including tags
    • Amino acids
      201 to 300
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Peptide Array

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Acute lymphoblastic leukemia cells antigen CD38
    • ADP ribosyl cyclase
    • ADP ribosyl cyclase 1
    • ADP ribosyl cyclase/cyclic ADP-ribose hydrolase
    • ADP-ribosyl cyclase 1
    • ADPRC 1
    • ADPRC1
    • cADPr hydrolase 1
    • CD 38
    • CD38
    • CD38 antigen
    • CD38 antigen (p45)
    • CD38 molecule
    • Cd38-rs1
    • CD38_HUMAN
    • CD38H
    • Cyclic ADP ribose hydrolase
    • Cyclic ADP ribose hydrolase 1
    • Cyclic ADP-ribose hydrolase 1
    • EC 3.2.2.5
    • Ecto nicotinamide adenine dinucleotide glycohydrolase
    • I-19
    • I19 (mouse)
    • Lymphocyte differentiation antigen CD38
    • NAD(+) nucleosidase
    • NIM-R5 antigen
    • NIMR5 antigen (mouse)
    • OTTHUMP00000158633
    • OTTHUMP00000217743
    • p45
    • T10
    see all
  • Function
    Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
  • Tissue specificity
    Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
  • Sequence similarities
    Belongs to the ADP-ribosyl cyclase family.
  • Developmental stage
    Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up