Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28907
    • SpeciesHuman
    • SequenceCDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDS RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
    • Molecular weight37 kDa including tags
    • Amino acids201 to 300
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Peptide Array

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Acute lymphoblastic leukemia cells antigen CD38
    • ADP ribosyl cyclase
    • ADP ribosyl cyclase 1
    • ADP ribosyl cyclase/cyclic ADP-ribose hydrolase
    • ADP-ribosyl cyclase 1
    • ADPRC 1
    • ADPRC1
    • cADPr hydrolase 1
    • CD 38
    • CD38
    • CD38 antigen
    • CD38 antigen (p45)
    • CD38 molecule
    • Cd38-rs1
    • CD38_HUMAN
    • CD38H
    • Cyclic ADP ribose hydrolase
    • Cyclic ADP ribose hydrolase 1
    • Cyclic ADP-ribose hydrolase 1
    • EC 3.2.2.5
    • Ecto nicotinamide adenine dinucleotide glycohydrolase
    • I-19
    • I19 (mouse)
    • Lymphocyte differentiation antigen CD38
    • NAD(+) nucleosidase
    • NIM-R5 antigen
    • NIMR5 antigen (mouse)
    • OTTHUMP00000158633
    • OTTHUMP00000217743
    • p45
    • T10
    see all
  • FunctionSynthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
  • Tissue specificityExpressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
  • Sequence similaritiesBelongs to the ADP-ribosyl cyclase family.
  • Developmental stagePreferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD38 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CD38 protein (ab112266)

ab112266 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"