Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQW SGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCN ITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLL GYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDS RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 300

Specifications

Our Abpromise guarantee covers the use of ab114253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acute lymphoblastic leukemia cells antigen CD38
    • ADP ribosyl cyclase
    • ADP ribosyl cyclase 1
    • ADP ribosyl cyclase/cyclic ADP-ribose hydrolase
    • ADP-ribosyl cyclase 1
    • ADPRC 1
    • ADPRC1
    • cADPr hydrolase 1
    • CD 38
    • CD38
    • CD38 antigen
    • CD38 antigen (p45)
    • CD38 molecule
    • Cd38-rs1
    • CD38_HUMAN
    • CD38H
    • Cyclic ADP ribose hydrolase
    • Cyclic ADP ribose hydrolase 1
    • Cyclic ADP-ribose hydrolase 1
    • EC 3.2.2.5
    • Ecto nicotinamide adenine dinucleotide glycohydrolase
    • I-19
    • I19 (mouse)
    • Lymphocyte differentiation antigen CD38
    • NAD(+) nucleosidase
    • NIM-R5 antigen
    • NIMR5 antigen (mouse)
    • OTTHUMP00000158633
    • OTTHUMP00000217743
    • p45
    • T10
    see all
  • Function
    Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
  • Tissue specificity
    Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
  • Sequence similarities
    Belongs to the ADP-ribosyl cyclase family.
  • Developmental stage
    Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human CD38 protein images

  • ab114253 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human CD38 protein (ab114253)

ab114253 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up