Recombinant Human CD39 protein (ab114445)

Overview

  • Product nameRecombinant Human CD39 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49961
    • SpeciesHuman
    • SequenceMEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYG IVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNE IGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLD VVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVP YETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYT HSFLCYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTP CTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTS YAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGW TLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFTVAIIGLLIFH KPSYFWKDMV
    • Molecular weight82 kDa including tags
    • Amino acids1 to 510

Specifications

Our Abpromise guarantee covers the use of ab114445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATPDase
    • CD 39
    • CD39
    • CD39 antigen
    • DKFZp686D194
    • DKFZp686I093
    • Ecto apyrase
    • Ecto ATP diphosphohydrolase
    • Ecto-apyrase
    • Ecto-ATP diphosphohydrolase 1
    • Ecto-ATPase 1
    • Ecto-ATPDase 1
    • Ectonucleoside triphosphate diphosphohydrolase 1
    • ENTP1_HUMAN
    • ENTPD 1
    • ENTPD1
    • FLJ40921
    • FLJ40959
    • Lymphoid cell activation antigen
    • NTPDase 1
    • NTPDase1
    • SPG64
    see all
  • FunctionIn the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation. Hydrolyzes ATP and ADP equally well.
  • Tissue specificityExpressed primarily on activated lymphoid cells. Also expressed in endothelial tissues. The vascular isoform and the placental isoform II are present in both placenta and umbilical vein, whereas placental isoform I is present in placenta only.
  • Sequence similaritiesBelongs to the GDA1/CD39 NTPase family.
  • Post-translational
    modifications
    The N-terminus is blocked.
    Palmitoylated in the N-terminal part.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CD39 protein images

  • ab114445 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human CD39 protein (ab114445)

ab114445 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. We have not tested this protein for activity, so unfortunately we have no data to provide in this regard.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"